PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 315aa    MW: 35347.2 Da    PI: 5.134
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615392.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.22.5e-3183140260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     dDg++WrKYGqK vkgs+fprsYY+Ct+++Cpv+kkve++  +++v+ei+Y+g Hnh+k
  XP_009615392.1  83 DDGFTWRKYGQKRVKGSNFPRSYYKCTQQSCPVRKKVECAP-NGQVIEIVYNGAHNHPK 140
                     8****************************************.***************85 PP

2WRKY36.87.8e-12291312223
                     --SS-EEEEEEE--TT-SS-EE CS
            WRKY   2 dDgynWrKYGqKevkgsefprs 23 
                     +Dgy+WrKYGqK+vkg+++pr 
  XP_009615392.1 291 EDGYRWRKYGQKVVKGNPNPRE 312
                     8*******************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.3E-2772140IPR003657WRKY domain
SuperFamilySSF1182902.48E-2480140IPR003657WRKY domain
SMARTSM007742.3E-3382140IPR003657WRKY domain
PfamPF031065.7E-2583139IPR003657WRKY domain
PROSITE profilePS5081121.57483141IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.8E-13275312IPR003657WRKY domain
SuperFamilySSF1182904.18E-9283311IPR003657WRKY domain
PROSITE profilePS5081115.548285315IPR003657WRKY domain
SMARTSM007740.0022290315IPR003657WRKY domain
PfamPF031062.0E-7291312IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MSSPPCWPAV LTIPPGISPA ALLDSPVMFP SSVTPTETNV QQTLNSIELT NKQIPQQEEF  60
TKKENQFEQN GVFSSSISPS SSDDGFTWRK YGQKRVKGSN FPRSYYKCTQ QSCPVRKKVE  120
CAPNGQVIEI VYNGAHNHPK TQSIRRPNMD NSYVIREVEE IGQENASVWR NQQFECNKNV  180
ISYNDNGLKR TSSASVLTEV SDPMSTNPKS MNVFESAGTP ELSSTLTSYD GDDGDWATQE  240
STLLGDDVNE YELEPKRRKK ESYSAEPSLL SRTVRESKVV LQVESEIDIL EDGYRWRKYG  300
QKVVKGNPNP REALA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-15831381874Probable WRKY transcription factor 4
2lex_A2e-15831381874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254260PKRRKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2387895e-48AC238789.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 5 clone C05HBa0142A20, complete sequence.
GenBankHG9754445e-48HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755175e-48HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615392.10.0PREDICTED: probable WRKY transcription factor 4 isoform X4
TrEMBLA0A0V0IJE01e-130A0A0V0IJE0_SOLCH; Putative WRKY transcription factor 4-like
STRINGPGSC0003DMT4000600421e-116(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-52WRKY DNA-binding protein 4